Lexie:Naturals : - Deodorant Lotion Lip Balm Diaper Cream Raw Materials SunLotion Beard Care Soap Soothing Balm lexie, lip, lotion, lip balm, chapstick, natural products

1.83 Rating by ClearWebStats
lexienaturals.com is 1 decade 2 years 6 months old. This website has a #1,476,705 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, lexienaturals.com is SAFE to browse.
Get Custom Widget

Traffic Report of Lexienaturals

Daily Unique Visitors: 326
Daily Pageviews: 652

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View lexienaturals.com Pagerank
Alexa Rank: 1,476,705
Domain Authority: Not Applicable
Google Pagerank
PR 1 out of 10
PageSpeed Score
31
Siteadvisor Rating
View lexienaturals.com site advisor rating Not Applicable

Where is lexienaturals.com server located?

Hosted IP Address:

108.174.144.140 View other site hosted with lexienaturals.com

Hosted Country:

lexienaturals.com hosted country US lexienaturals.com hosted country

Location Latitude:

36.0984

Location Longitude:

-94.1524

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): 148
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View lexienaturals.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 13
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 108.174.144.140)

Thirst | Communication Design Practice

lexienaturals.com favicon - 3st.com

Thirst is a communication design practice based in Chicago. We work with the design, cultural, and civic communities. As designers, we cultivate conversations. We engage in a process of discovery and experimentation, focusing on concept, craft, and artful investigation. Our work lives at the threshold between art and science, resulting in keepsake artifacts and unique experiences.

View lexienaturals.com Pagerank   lexienaturals.com alexa rank 1,293,064   lexienaturals.com website value $ 480.00

Less Made | the Works of Jared Erickson

lexienaturals.com favicon - lessmade.com

Less Made llc, a small company started by Jared Erickson, Creating design, furniture, and other shenanigans

View lexienaturals.com Pagerank   lexienaturals.com alexa rank 279,405   lexienaturals.com website value $ 18,360.00


Eddy | Metaphysical

lexienaturals.com favicon - eddymusic.com

eddy is a 4′11″ish journal collecting cupcake baker with an affinity for the scratching noises on old records who is more than a little unclear on exactly what her natural hair color is and a singer/songwriter/procrastinator extraordinaire.

View lexienaturals.com Pagerank   lexienaturals.com alexa rank 7,849,766   lexienaturals.com website value $ 8.95

Bonzi | Sports Management and online registration made easy.

lexienaturals.com favicon - bonzicentral.com

View lexienaturals.com Pagerank   lexienaturals.com alexa rank 1,914,814   lexienaturals.com website value $ 480.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 09 Jun 2015 10:27:09 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Domain Information for lexienaturals.com

Domain Registrar: 1 & 1 INTERNET AG lexienaturals.com registrar info
Registration Date: 2011-10-15 1 decade 2 years 6 months ago
Last Modified: 2014-10-15 9 years 6 months 1 week ago
Expiration Date: 2015-10-15 8 years 6 months 1 week ago

Domain Nameserver Information

Host IP Address Country
dns.site5.com lexienaturals.com name server information 162.215.1.172 lexienaturals.com server is located in United States United States
dns2.site5.com lexienaturals.com name server information 162.215.1.178 lexienaturals.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
lexienaturals.com A 3599 IP:108.174.144.140
lexienaturals.com NS 3599 Target:dns.site5.com
lexienaturals.com NS 3599 Target:dns2.site5.com
lexienaturals.com SOA 3599 MNAME:dns.site5.com
RNAME:hostmaster.site5.com
Serial:2015031001
Refresh:3600
Retry:3600
Expire:604800
lexienaturals.com MX 3599 Priority:10
Target:lexienaturals.com

Similarly Ranked Websites to Lexienaturals

Analogue

lexienaturals.com favicon - analogueinteractive.com

exceptional video game hardware

View lexienaturals.com Pagerank   Alexa rank for lexienaturals.com 1,476,708   website value of lexienaturals.com $ 480.00

Aniruddha.tv

lexienaturals.com favicon - aniruddha.tv

Official website of Aniruddha TV

View lexienaturals.com Pagerank   Alexa rank for lexienaturals.com 1,476,708   website value of lexienaturals.com $ 480.00

בשמים KOKO Perfume בושם לגבר בושם לאישה UA-53425768-1

lexienaturals.com favicon - koko.co.il

בשמים KOKO Perfume בושם לאשה לגבר בושם לאישה במבצע מגוון קלווין קליין chanel בולגארי אליאן alien coco קוקו

View lexienaturals.com Pagerank   Alexa rank for lexienaturals.com 1,476,710   website value of lexienaturals.com $ 480.00

Testberichte Erfahrungsberichte Blog

lexienaturals.com favicon - allucansurf.de

Erfahrungsberichte Testberichte Fotos Bilder

View lexienaturals.com Pagerank   Alexa rank for lexienaturals.com 1,476,710   website value of lexienaturals.com $ 480.00

شركة كشف تسربات المياه بالرياض (الموقع للايجار

lexienaturals.com favicon - companydetectleakswaterinriyadh.com

شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من

View lexienaturals.com Pagerank   Alexa rank for lexienaturals.com 1,476,711   website value of lexienaturals.com $ 480.00